PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 38995
Common NameSELMODRAFT_38995
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ZF-HD
Protein Properties Length: 64aa    MW: 7008.89 Da    PI: 5.9588
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
38995genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.53.3e-33258259
  ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                 ++v+Y+eClkNhAas+Ggh++DGCgEfmp  geegt++alkCaAC+CHRnFH+reve 
        38995  2 KTVHYRECLKNHAASIGGHSLDGCGEFMPC-GEEGTMEALKCAACDCHRNFHKREVEG 58
                 689**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-22361IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.2E-30456IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.3E-30556IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.313655IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
SKTVHYRECL KNHAASIGGH SLDGCGEFMP CGEEGTMEAL KCAACDCHRN FHKREVEGEP  60
LVCD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002981262.14e-41hypothetical protein SELMODRAFT_38995, partial
SwissprotQ9FRL53e-28ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLD8SD404e-41D8SD40_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ179631e-40(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.12e-29homeobox protein 33
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]